LL-37 (Cap-18) Pre Mixed Peptide
LL-37 is supplied by Direct SARMS Dubai as a 5 mg pre-mixed pen format containing laboratory research material associated with cathelicidin peptide research.
98% purityBatch COA includedStore 2–8°C
Price range: $51.78 through $148.92
Buy more, save more
7.5% offspend $250.00
12.5% offspend $400.00
Spend $250.00 for 7.5% off on qualifying items · Applied automatically at checkout
Researchers who bought LL-37 (Cap-18) Pre Mixed Peptide also bought
LL-37 (Cap-18) Pre Mixed Peptide
LL-37 is a cathelicidin peptide investigated in relation to innate immune signalling and host-defence biology. Published research examines LL-37 across areas including epithelial repair, inflammatory signalling, microbial interactions, and biofilm-related research. Direct SARMS Dubai supplies this 5mg research material in a pre-mixed pen format, with a pen kit or individual pre-mixed cartridges available.
Benefits of the pre-mixed pen format
1
The formulation is pre-mixed. The peptide is provided in liquid form so that researchers do not need to reconstitute a lyophilized product before use.
2
Controlled dispensing. The pen mechanism allows researchers to choose and dispense precise volumes consistently throughout the procedures.
3
Convenient format. It is a convenient format because it combines the peptide formulation and dispensing mechanism in one compact design.
4
Reduced handling. Less handling is involved because the formulation is already inside the pen; unlike conventional vial formats, fewer steps for preparation and transfer are needed.
5
The preparation is straightforward. Since the mixture is already prepared, it makes laboratory handling easier by removing the need for separate reconstitution and liquid transfer.
Read the LL-37 (Cap-18) research guide ▸
LL-37 (Cap-18) is supplied exclusively for laboratory research use. The information on this page is provided for scientific and educational reference and is based on available published research. This product is not intended for human or veterinary use, diagnosis, treatment, or prevention of any disease or medical condition. It is intended solely for qualified laboratory research and must be handled in accordance with applicable laboratory safety requirements.
Buy LL-37 (Cap-18) Pre Mixed Peptide Dubai from Direct SARMS.
Additional information
| Size(s) | 5mg |
| Purity | 98% |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493.26 g/mol |
| Sequence | [LL-37, 37 aa] |
| Physical Form | Pre-Mixed Peptide Cartridge |
| Storage | 2–8°C |
General information
Applies to all Direct Sarms research compounds unless noted otherwise on the product.
Storage & handling
Store the pre-mixed pen according to the instructions provided on the product label. As the formulation is supplied in liquid form, follow any product-specific refrigeration requirements and protect the pen from excessive heat and direct light. Do not freeze unless the product label specifically states otherwise.
Shipping & discretion
Fully tracked dispatch with worldwide shipping available. Sent in plain, discreet outer packaging with no product description on the label.
FDA disclosure & intended use
These statements have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure or prevent any disease. Research use only — not for human or animal consumption. You must be 18+ and a qualified researcher.
Got a question about this LL-37 (Cap-18) compound?
The LL-37 Pen Kit includes: 1 x Cartridge premixed with LL-37 (Cap 18) 5mg & Bacteriostatic Water 1 x Peptide Cartridge Pen & Carry Case 3 x Pen Needle Tips
Yes all peptide pen kits have refill cartridges available.
No the pre-mixed peptide pen is suppled ready reconstituted.
Keep Refrigerated At 2–8°C
Certificate of Analysis
| Identity | LL-37 (Cap-18) | CONFORMS |
| Purity (HPLC) | 98% | CONFORMS |
| Mass (LC-MS) | 4493.26 g/mol | CONFORMS |
| Appearance | Pre-Mixed Peptide Cartridge | CONFORMS |
